1
–
15
von
208
Ergebnisse

RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 405, Novus Biologicals™
Rabbit Monoclonal Antibody
Bromodeoxyuridine/BrdU Antibody (SPM166), Janelia Fluor™ 549, Novus Biologicals™
Mouse Monoclonal Antibody
R&D Systems™ Human Mesenchymal Stem Cell Verification Flow Kit
Provides single-step staining for the verification of human MSCs
Human FGFR1 alpha (IIIc) Alexa Fluor™ 647-conjugated Antibody, R&D Systems™
Mouse Monoclonal Antibody
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), PerCP, Novus Biologicals™
Rabbit Monoclonal Antibody
Klon | 1049417 |
---|---|
Rekonstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Form | Purified |
Gen-Zugriffsnummer | YP_009724390.1 |
Konjugat | Unconjugated |
Isotype | IgG1 |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Zusammensetzung | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Klassifikation | Monoclonal |
Antigen | Spike RBD |
Regulatorischer Status | RUO |
Immunogen | Human embryonic kidney cell, HEK293-derived sars-cov-2 Spike S1 Subunit protein, Val16-Pro681, Accession # YP_009724390.1 |
Zielspezies | SARS-CoV-2 |
Wirtsspezies | Mouse |
Reinigungsverfahren | Protein A or G purified from hybridoma culture supernatant |
Anwendungen | Blocking Assay,Neutralization,Immunocytochemistry |
Verdünnung | Blockade of Receptor-ligand Interaction, Neutralization, Immunocytochemistry 8-25 ug/mL |
Klon | 2771C |
---|---|
Rekonstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Form | Purified |
Gen-Zugriffsnummer | P14222 |
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Zusammensetzung | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Klassifikation | Monoclonal |
Antigen | Perforin |
Regulatorischer Status | RUO |
Immunogen | Chinese Hamster Ovary cell line CHO-derived human Perforin, Pro22-Trp555, Accession # P14222 |
Zielspezies | Human |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Protein A or G purified from cell culture supernatant |
Anwendungen | Immunohistochemistry |
Verdünnung | Immunohistochemistry 5-25 ug/mL |
Gen-Alias | Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFP, PFPcytolysin, PRF1 |
Gen-ID (Entrez) | 5551 |
Form | Purified |
---|---|
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
Zusammensetzung | PBS (pH 7.3), 50% glycerol |
Klassifikation | Polyclonal |
Antigen | OCTN1/SLC22A4 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2). LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK |
Zielspezies | Human,Mouse,Rat |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Affinity purified |
Anwendungen | Western Blot |
Verdünnung | Western Blot 1:1000-1:2000 |
Gen-Alias | Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H |
Gen-ID (Entrez) | 6583 |
Klon | STING1/8187R |
---|---|
Form | Purified |
Konjugat | Unconjugated |
Isotype | IgG κ |
Konzentration | 0.2 mg/ml |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4&drg;C. Do not freeze. |
Zusammensetzung | 10mM PBS with 0.05% BSA |
Klassifikation | Monoclonal |
Antigen | STING/TMEM173 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fragment (around aa190-290) of human STING/TMEM173 protein (exact sequence is proprietary) |
Zielspezies | Human |
Forschungsgebiet | Cancer, Immunology, Innate Immunity |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Protein A or G purified |
Anwendungen | Immunohistochemistry (Paraffin) |
Verdünnung | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gen-Alias | endoplasmic reticulum IFN stimulator, Endoplasmic reticulum interferon stimulator, ERIS, FLJ38577, hMITA, hSTING, Mediator of IRF3 activation, MITA, mitochondrial mediator of IRF3 activation, MPYS, NET23, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, SAVI, Stimulator of interferon genes protein, stimulator of interferon protein, sting, STING-beta, TMEM173, transmembrane protein 173 |
Gen-ID (Entrez) | 340061 |
Klon | 2906A |
---|---|
Rekonstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Form | Purified |
Gen-Zugriffsnummer | Q08554 |
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Zusammensetzung | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Klassifikation | Monoclonal |
Antigen | Desmocollin-1 |
Regulatorischer Status | RUO |
Immunogen | Mouse myeloma cell line, NS0-derived human Desmocollin-1, Arg135-Asn686, Accession # Q08554 |
Zielspezies | Human |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Protein A or G purified from hybridoma culture supernatant |
Anwendungen | Immunohistochemistry |
Verdünnung | Immunohistochemistry 3-25 ug/mL |
Gen-Alias | cadherin family member 1, CDHF1, desmocollin 1, desmocollin-1, Desmocollin1, desmosomal glycoprotein 2/3, DG2/DG3, DSC1 |
Gen-ID (Entrez) | 1823 |
Novus Biologicals™ alpha Satellite Repeat Primer
alpha SAT primer for PCR in chromatin precipitation
Inhalt und Lagerung | Store at –20°C. Avoid Free/Thaw Cycles |
---|---|
Zur Verwendung mit (Anwendung) | Chromatin-Immunpräzipitation |
Produkttyp | alpha Satellite Repeat Primer |