missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IBA1 Polyclonal Antibody, Invitrogen™
Rabbit Polyclonal Antibody
Marke: Thermo Scientific PA595409
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL.
AIF1 is induced by cytokines and interferon. It is thought to be involved in the negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma.
Spezifikation
| IBA1 | |
| Polyclonal | |
| Unconjugated | |
| AIF1 | |
| AI607846, AIF1, AIF-1, Allograft inflammatory factor 1, balloon angioplasty responsive transcript, balloon angioplasty-responsive transcript 1, Bart1, BART-1, D17H6S50E, DADB-70P7.8, DASS-82G15.2, Em:AF129756.17, G1, Iba, Iba1, interferon gamma responsive transcript, ionized calcium binding adapter molecule 1, ionized calcium-binding adapter molecule 1, IRT1, IRT-1, microglia response factor, Mrf1, MRF-1, protein BART-1, protein G1, testis specific | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 199 | |
| Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. | |
| Lyophilized |
| Immunohistochemistry (Paraffin), Western Blot | |
| 500 μg/mL | |
| PBS with 4MG trehalose and 0.05MG sodium azide | |
| P55008 | |
| AIF1 | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Produktvorschläge
Kunden, die diesen Artikel ansahen, interessierten sich auch für
Viewing 1-5 of 12
-
Catalog No. 10125092
922,00 € / 300 Einheiten -
Catalog No. 10678484
205,00 € / 500 Milliliter -
Catalog No. 10671531
703,00 € / 15 Milliliter -
Catalog No. 13464189
105,00 € / 5 Stück -
Catalog No. 10647894
280,00 € / 250 Milliliter -
Catalog No. 10116287
187,00 € / 1 Milliliter -
Catalog No. 17821163
Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech
226,00 € / 100 Mikrogramm -
Catalog No. 11570806
656,00 € / 5 Milligramm -
Catalog No. 17833373
Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech
87,25 € / 100 Mikrogramm -
Catalog No. 15137105
12.215,00 € / 1 Stück -
Catalog No. 10347642
345,00 € / 1 Stück -
Catalog No. 11514270
862,00 € / 100 Mikroliter
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
IBA1 Polyclonal Antibody, Invitrogen™ > 100 μg; Unconjugated
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
