Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marke: Novus Biologicals™ NBP2-57833PEP

Artikelnummer. 18274113

259.00 € / 100 Mikroliter

Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPAR gamma/NR1C3. Source: E.coli Amino Acid Sequence: DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC The PPAR gamma/NR1C3 Recombinant Protein Antigen is derived from E. coli. The PPAR gamma/NR1C3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Spezifikation

Gene ID (Entrez)	5468
Gebräuchliche Bezeichnung	PPAR gamma/NR1C3 Recombinant Protein Antigen
Zusammensetzung	PBS and 1M Urea, pH 7.4
Gen-Alias	CIMT1, NR1C3GLM1, Nuclear receptor subfamily 1 group C member 3, peroxisome proliferator-activated receptor gamma, peroxisome proliferator-activated receptor gamma 1, PPAR gamma, PPARG1peroxisome proliferative activated receptor, gamma, PPARG2PPARgamma, P
Markertyp	Unmarkiert
Menge	100 μl
Quelle	E. coli

Reinigungsverfahren	>80% by SDS-PAGE and Coomassie blue staining
Inhalt und Lagerung	Store at −20°C. Avoid freeze-thaw cycles
Zur Verwendung mit (Anwendung)	Blocking/Neutralizing, Control
Gensymbol	PPARG
Produkttyp	Recombinant Protein Antigen
Kennzeichnung	RUO
Spezifische Reaktivität	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50015. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Produktvorschläge

Kunden, die diesen Artikel ansahen, interessierten sich auch für This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500 Milliliter
Catalog No. 13464189

Thermo Scientific ™ Pierce ™ Trypsin/Lys-C Pr Thermo Scientific ™ Pierce ™ Trypsin/Lys-C Pr

105,00 € / 5 Stück
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ Ultra TMB-ELISA Thermo Scientific ™ 1-Step ™ Ultra TMB-ELISA

280,00 € / 250 Milliliter
Catalog No. 11560626

Gibco ™ Trypsin-EDTA (0,25%), phenolrot Gibco ™ Trypsin-EDTA (0,25%), phenolrot

24,35 € / 100 Milliliter
Catalog No. 11580626

Gibco ™ Trypsin-EDTA (0.05 %), Phenolrot Gibco ™ Trypsin-EDTA (0.05 %), Phenolrot

22,80 € / 100 Milliliter
Catalog No. 11548876

Gibco ™ Penicillin-Streptomycin (10.000 U/ml) Gibco ™ Penicillin-Streptomycin (10.000 U/ml)

27,37 € / 100 Milliliter
Catalog No. 10729174

Invitrogen ™ Goat anti-Rabbit IgG (H+L) Cross- Invitrogen ™ Goat anti-Rabbit IgG (H+L) Cross-

311,00 € / 500 Mikroliter
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR-System, 96 Applied Biosystems ™ ProFlex ™ PCR-System, 96

12.215,00 € / 1 Stück
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

862,00 € / 100 Mikroliter
Catalog No. 17338583

MP Biomedicals ™ Poly-L-Lysine Hydrochloride MP Biomedicals ™ Poly-L-Lysine Hydrochloride

463,00 € / 100 Milligramm
Catalog No. 15476929

Thermo Scientific Chemicals Kisspeptin-10 Thermo Scientific Chemicals Kisspeptin-10

74,37 € / 1 Milligramm

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen > Quantity: 100μL

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Nur für Forschungszwecke.

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Sonderangebote

Kürzlich angesehene Artikel ...Anzeigen