Test
Mouse Monoclonal Antibody
Form | Purified |
---|---|
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
Zusammensetzung | PBS (pH 7.3), 50% glycerol |
Klassifikation | Polyclonal |
Antigen | OCTN1/SLC22A4 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2). LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK |
Zielspezies | Human,Mouse,Rat |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Affinity purified |
Anwendungen | Western Blot |
Verdünnung | Western Blot 1:1000-1:2000 |
Gen-Alias | Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H |
Gen-ID (Entrez) | 6583 |
Designed for the flow cytometric analysis of mDCs using four fluorochrome-conjugated antibodies
Klon | 2906A |
---|---|
Rekonstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Form | Purified |
Gen-Zugriffsnummer | Q08554 |
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Zusammensetzung | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Klassifikation | Monoclonal |
Antigen | Desmocollin-1 |
Regulatorischer Status | RUO |
Immunogen | Mouse myeloma cell line, NS0-derived human Desmocollin-1, Arg135-Asn686, Accession # Q08554 |
Zielspezies | Human |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Protein A or G purified from hybridoma culture supernatant |
Anwendungen | Immunohistochemistry |
Verdünnung | Immunohistochemistry 3-25 ug/mL |
Gen-Alias | cadherin family member 1, CDHF1, desmocollin 1, desmocollin-1, Desmocollin1, desmosomal glycoprotein 2/3, DG2/DG3, DSC1 |
Gen-ID (Entrez) | 1823 |
For single-step staining of human/mouse pluripotent stem cells (h/mPSCs) (1-7)
Rabbit Polyclonal Antibody
Klon | rKRT10/6923 |
---|---|
Form | Purified |
Konjugat | Unconjugated |
Isotype | IgG1 κ |
Konzentration | 0.2 mg/ml |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4&drg;C. Do not freeze. |
Zusammensetzung | 10mM PBS with 0.05% BSA |
Klassifikation | Monoclonal |
Antigen | Cytokeratin 10 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fragment (around aa384-584) of human Cytokeratin 10 protein (exact sequence is proprietary) |
Zielspezies | Human |
Forschungsgebiet | Cell Biology, Cellular Markers |
Wirtsspezies | Mouse |
Reinigungsverfahren | Protein A or G purified |
Anwendungen | Immunohistochemistry (Paraffin) |
Verdünnung | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gen-Alias | BCIE, BIE, CK10, CK-10, cytokeratin 10, Cytokeratin-10, EHK, K10keratosis palmaris et plantaris, keratin 10, Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris), keratin, type I cytoskeletal 10, keratin-10, KPP |
Gen-ID (Entrez) | 3858 |
Rabbit Monoclonal Antibody
alpha SAT primer for PCR in chromatin precipitation
Inhalt und Lagerung | Store at –20°C. Avoid Free/Thaw Cycles |
---|---|
Zur Verwendung mit (Anwendung) | Chromatin-Immunpräzipitation |
Produkttyp | alpha Satellite Repeat Primer |