missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OCTN1/SLC22A4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
207.00 € - 470.00 €
Spezifikation
| Antigen | OCTN1/SLC22A4 |
|---|---|
| Verdünnung | Western Blot 1:1000-1:2000 |
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18676122
|
Novus Biologicals
NBP2-94155-0.02ml |
0.02 mL |
207.00 €
0.02 Milliliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18600392
|
Novus Biologicals
NBP2-94155-0.1ml |
0.1 mL |
470.00 €
0.10 Milliliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
OCTN1/SLC22A4 Polyclonal antibody specifically detects OCTN1/SLC22A4 in Human, Mouse, Rat samples. It is validated for Western BlotSpezifikation
| OCTN1/SLC22A4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2). LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:1000-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6583 | |
| IgG | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts