missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-12 R beta 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-57287-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
IL-12 R beta 1 Polyclonal specifically detects IL-12 R beta 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| IL-12 R beta 1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CD212, CD212 antigen, IL-12 receptor beta component, IL-12 receptor subunit beta-1, IL12R, IL-12R subunit beta-1, IL12RB, IL-12RB1, IL-12R-beta-1, IL-12R-BETA1, interleukin 12 receptor, beta 1, interleukin-12 receptor beta-1 chain, interleukin-12 receptor subunit beta-1, MGC34454 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| IL12RB1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES | |
| 25 μL | |
| Cell Cycle and Replication | |
| 3594 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur