missing translation for 'onlineSavingsMsg'
Learn More

Drucken

Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein

Recombinant Protein

Marke: Invitrogen™ RP91392

176.67 EUR gültig bis 2025-03-21
Benutzen Sie den Promotions-Code "24111" um Ihren Promotions-Preis zu erhalten.

Artikelnummer. 30200510

265.00 € / 100 Mikroliter

Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Benachrichtigungen:

Um den Rabatt von 33.33 % zu erhalten, müssen Kunden drei Einheiten desselben Produkts zum Listenpreis in einer einzigen Bestellung kaufen. Es gibt keine Begrenzung für die Anzahl von 3er Sets, die Kunden kaufen können. PCODE: 24111

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64867 (PA5-64867, PA5-51512 (PA5-51512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.

Spezifikation

Zugriffsnummer	Q9Y3I0
Zur Verwendung mit (Anwendung)	Blocking Assay, Control
Gen-ID (Entrez)	51493
Menge	100 μL
Gen-Alias	3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; ankyrin repeat domain 54; C22orf28; C5H22orf28; D10Wsu52e; DJ149A16.6; FAAP; focal adhesion-associated protein; HAMAP-Rule:MF_03144}; HSPC117; hypothetical protein HSPC117; hypothetical protein LOC406376; hypothetical protein LOC525106; P55; RNA 2',3'-cyclic phosphate and 5'-OH ligase; RNA-splicing ligase RtcB homolog; RTCB; tRNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog {ECO:0000255; zgc:76871
Gensymbol	Rtcb
Spezies	Human
Proteinmarkierung	His-ABP-tag
Inhalt und Lagerung	-20°C, Avoid Freeze/Thaw Cycles
Form	Liquid

Konzentration	≥5.0 mg/mL
Zusammensetzung	1 M urea, PBS with no preservative; pH 7.4
Name	Human RTCB (aa 340-499) Control Fragment
Kennzeichnung	RUO
Gebräuchliche Bezeichnung	RTCB
Konjugat	Unconjugated
Rekombinant	Recombinant
Sequenz	PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP
Expressionssystem	E. coli
Reinheits- oder Qualitätsgrad	>80% by SDS-PAGE and Coomassie blue staining

Produktvorschläge

Kunden, die diesen Artikel ansahen, interessierten sich auch für This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 11

Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500 Milliliter
Catalog No. 13464189

Thermo Scientific ™ Pierce ™ Trypsin/Lys-C Pr Thermo Scientific ™ Pierce ™ Trypsin/Lys-C Pr

105,00 € / 5 Stück
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ Ultra TMB-ELISA Thermo Scientific ™ 1-Step ™ Ultra TMB-ELISA

280,00 € / 250 Milliliter
Catalog No. 11560626

Gibco ™ Trypsin-EDTA (0,25%), phenolrot Gibco ™ Trypsin-EDTA (0,25%), phenolrot

24,35 € / 100 Milliliter
Catalog No. 11580626

Gibco ™ Trypsin-EDTA (0.05 %), Phenolrot Gibco ™ Trypsin-EDTA (0.05 %), Phenolrot

22,80 € / 100 Milliliter
Catalog No. 11548876

Gibco ™ Penicillin-Streptomycin (10.000 U/ml) Gibco ™ Penicillin-Streptomycin (10.000 U/ml)

27,37 € / 100 Milliliter
Catalog No. 10729174

Goat anti-Rabbit IgG (H+L) Cross-Adsorbed Secon Goat anti-Rabbit IgG (H+L) Cross-Adsorbed Secon

311,00 € / 500 Mikroliter
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR-System, 96 Applied Biosystems ™ ProFlex ™ PCR-System, 96

12.215,00 € / 1 Stück
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

862,00 € / 100 Mikroliter
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100 Mikrogramm
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100 Mikrogramm

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein

Benachrichtigungen:

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Sonderangebote

Kürzlich angesehene Artikel ...Anzeigen